Gene Mb1835
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe20 |
| Comments | Mb1835, PE20, len: 99 aa. Equivalent to Rv1806,len: 99 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 99 aa overlap). Member of the Mycobacterium tuberculosis PE family of gly-, ala-rich proteins, most similar to Rv1788|MTV049.10|AL022021 (99 aa), FASTA scores: opt: 334, E(): 4.7 e-15, (59.8% identity in 97 aa overlap). |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2038527 | 2038826 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1835|PE20
MAFVLVCPDALAIAAGQLRHVGSVIAARNAVAAPATAELAPAAADEVSALTATQFNFHAAMYQAVGAQAIAMNEAFVAMLGASADSYAATEAANIIAVS
Bibliography
No article yet recorded