Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPE family protein PE20
CommentsRv1806, (MTV049.28), len: 99 aa. PE20, Member of the Mycobacterium tuberculosis PE family of gly-, ala-rich proteins (see citation below), most similar to Rv1788|MTV049.10|AL022021 (99 aa), FASTA scores: opt: 334, E(): 4.7 e-15, (59.8% identity in 97 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryPe/ppe
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011).
TranscriptomicsDNA microarrays and qRT-PCR show higher level of expression in M. tuberculosis H37Rv during Mg2+ starvation (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS20480722048371+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1806|PE20
MAFVLVCPDALAIAAGQLRHVGSVIAARNAVAAPATAELAPAAADEVSALTATQFNFHAAMYQAVGAQAIAMNEAFVAMLGASADSYAATEAANIIAVS