Gene Mb1878
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb1878, -, len: 140 aa. Equivalent to Rv1847, len: 140 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 140 aa overlap=. Conserved hypothetical protein, possible thioesterase, some similarity to YBDB proteins of Escherichia coli and H. influenzae e.g. P15050|YBDB_ECOLI HYPOTHETICAL 15.0 KD PROTEIN IN ENTA-CSTA INTERGENIC REGION (137 aa), FASTA scores: opt: 232, E(): 6.6e-10, (35.8% identity in 106 aa overlap); C48956|G142208 thioesterase from Arthrobacter sp (151 aa),FASTA score: opt: 254, E(): 1.7e-11, (33.3% identity in 138 aa overlap). Also similar to AF064959|AF064959_1 hypothetical protein from Coxiella burnetii (148 aa),FASTA score: opt: 264, E(): 9.3e- 12, (36.8% identity in 117 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2087086 | 2087508 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1878|Mb1878 MQPSPDSPAPLNVTVPFDSELGLQFTELGPDGARAQLDVRPKLLQLTGVVHGGVYCAMIESIASMAAFAWLNSHGEGGSVVGVNNNTDFLRSISSGMVYGTAEPLHRGRRQQLWLVTITDDTDRVVARGQVRLQNLEARP
Bibliography
No article yet recorded