Gene Mb1880
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | urease beta subunit ureb (urea amidohydrolase) |
| Comments | Mb1880, ureB, len: 104 aa. Equivalent to Rv1849,len: 104 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 104 aa overlap). ureB, urease beta subunit (EC 3.5.1.5). Identical to URE2_MYCTU|P50048 urease beta subunit from Mycobacterium tuberculosis (100 aa). BELONGS TO THE UREASE GAMMA SUBUNIT FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2087856 | 2088170 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1880|ureB
MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIVGLVPLGGRREVPGLTLNPPGRLDR
Bibliography
No article yet recorded