Gene Rv1849
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the conversion of urea to NH3 [catalytic activity: urea + H2O = CO2 + 2 NH3] |
| Product | Urease beta subunit UreB (urea amidohydrolase) |
| Comments | Rv1849, (MTCY359.24c), len: 104 aa. UreB, urease beta subunit. Identical to URE2_MYCTU|P50048 urease beta subunit from Mycobacterium tuberculosis (100 aa). Belongs to the urease gamma subunit family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2097647 | 2097961 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1849|ureB
MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIVGLVPLGGRREVPGLTLNPPGRLDR
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
