Gene Mb1906
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1906, -, len: 147 aa. Equivalent to Rv1875, len: 147 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 147 aa overlap). Conserved hypothetical protein. Some similarity to Mycobacterium tuberculosis hypothetical proteins e.g. Rv1155|MTCI65.22|Z95584 (147 aa), FASTA scores: opt: 178,E(): 7.4e-06, (26.9% identity in 130 aa overlap); Rv0121c and Rv2074. Also similar to AL079356|SC6G9.21 hypothetical protein from Streptomyces coelicolor (144 aa), FASTA scores: opt: 239, E(): 3.1 e-09, (38.7% identity in 137 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2114590 | 2115033 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1906|Mb1906
MTTLNEAAALAAAERGLAVVSTVRADGTVQASLVNVGLLPHPVSGEPSLGFTTYGKVKLGNLRARPQLAVTFRNGWQWATVEGRAQLVGPDDPRPWLVDGERLRLLLREVFTAAGGTHDDWDEYDRVMAQEQRAVVLITPTRIYSNG
Bibliography
No article yet recorded