Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv1875, (MTCY180.43c), len: 147 aa. Conserved protein. Some similarity to Mycobacterium tuberculosis hypothetical proteins e.g. Rv1155|MTCI65.22|Z95584 (147 aa), FASTA scores: opt: 178, E(): 7.4e-06, (26.9% identity in 130 aa overlap); Rv0121c and Rv2074. Also similar to AL079356|SC6G9.21 hypothetical protein from Streptomyces coelicolor (144 aa), FASTA scores: opt: 239, E(): 3.1 e-09, (38.7% identity in 137 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified by proteomics (See Rosenkrands et al., 2000). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21243812124824+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1875|Rv1875
MTTLNEAAALAAAERGLAVVSTVRADGTVQASLVNVGLLPHPVSGEPSLGFTTYGKVKLGNLRARPQLAVTFRNGWQWATVEGRAQLVGPDDPRPWLVDGERLRLLLREVFTAAGGTHDDWDEYDRVMAQEQRAVVLITPTRIYSNG
      
Bibliography