Gene Mb1918c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | secreted antigen 85-B fbpB (85B) (antigen 85 complex B) (Mycolyl transferase 85B) (Fibronectin-binding protein B) (Extracellular alpha-antigen) |
Comments | Mb1918c, fbpB, len: 325 aa. Equivalent to Rv1886c,len: 325 aa, from Mycobacterium tuberculosis strain H37Rv (100.0% identity in 325 aa overlap). fbpB (alternate gene names: mpt59, 85B), precursor of the 85-B antigen (fibronectin-binding protein B) (mycolyl transferase 85B) (EC 2.3.1.-) (see citations below), highly similar to other Mycobacterial antigen precursors e.g. P12942|A85B_MYCBO ANTIGEN 85-B PRECURSOR from Mycobacterium bovis (323 aa); P21160|A85B_MYCKA ANTIGEN 85-B PRECURSOR from Mycobacterium kansasii (325 aa); etc. Also highly similar to Mycobacterium tuberculosis antigen precursors: Rv3804c|fbpA (338 aa), Rv0129c|fbpC2 (340 aa),and Rv3803c|fbpC1 (299 aa). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2125115 | 2126092 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1918c|fbpB MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Bibliography
No article yet recorded