Gene Mb1941c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1941c, -, len: 156 aa. Equivalent to Rv1906c,len: 156 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 156 aa overlap). Conserved hypothetical protein, possibly exported protein,equivalent to Mycobacterium leprae AJ000521|MLCOSL672.01 (153 aa), FASTA scores: opt: 637, E(): 2.6e-28, (63.2% identity in 155 aa overlap). Also similar to M. tuberculosis hypothetical exported protein, Rv1352. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2142705 | 2143175 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1941c|Mb1941c
MRLKPAPSPAAAFAVAGLILAGWAGSVGLAGADPEPAPTPKTAIDSDGTYAVGIDIAPGTYSSAGPVGDGTCYWKRMGNPDGALIDNALSKKPQVVTIEPTDKAFKTHGCQPWQNTGSEGAAPAGVPGPEAGAQLQNQLGILNGLLGPTGGRVPQP
Bibliography
No article yet recorded