Gene Mb1944c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Ferric uptake regulation protein FurA (fur) |
Comments | Mb1944c, len: 147 aa. Equivalent to Rv1909c len: 147 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 147 aa overlap). FurA, Ferric uptake regulation protein, similar to Q48835 legionella pneumophila 130B (wadsworth) ferric uptake regulation (136 aa), FASTA results: opt: 230, E(): 2.5e-09, (32.3% identity in 133 aa overlap). Also similar to Mycobacterium tuberculosis zur zinc uptake regulatory protein, Rv2359. Belongs to the fur family. Start changed since original submission (-3 aa). |
Functional category | Regulatory proteins |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2146429 | 2146872 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1944c|furA MSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP
Bibliography
No article yet recorded