Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionActs as a global negative controlling element, employing FE(2+) as a cofactor to bind the operator of the repressed genes. Seems to regulate transcription of KATG|Rv1908c gene.
ProductFerric uptake regulation protein FurA (fur)
CommentsRv1909c, (MTCY180.09), len: 147 aa. FurA, Ferric uptake regulation protein, similar to Q48835 legionella pneumophila 130B (wadsworth) ferric uptake regulation (136 aa), FASTA results: opt: 230, E(): 2.5e-09, (32.3% identity in 133 aa overlap). Also similar to Mycobacterium tuberculosis zur zinc uptake regulatory protein, Rv2359. Belongs to the fur family. Start changed since original submission (-3 aa).
Functional categoryRegulatory proteins
ProteomicsIdentified by proteomics (see proteomics citations). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21561492156592-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1909c|furA
VSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP
      
Bibliography