Gene Rv1909c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Acts as a global negative controlling element, employing FE(2+) as a cofactor to bind the operator of the repressed genes. Seems to regulate transcription of KATG|Rv1908c gene. |
| Product | Ferric uptake regulation protein FurA (fur) |
| Comments | Rv1909c, (MTCY180.09), len: 147 aa. FurA, Ferric uptake regulation protein, similar to Q48835 legionella pneumophila 130B (wadsworth) ferric uptake regulation (136 aa), FASTA results: opt: 230, E(): 2.5e-09, (32.3% identity in 133 aa overlap). Also similar to Mycobacterium tuberculosis zur zinc uptake regulatory protein, Rv2359. Belongs to the fur family. Start changed since original submission (-3 aa). |
| Functional category | Regulatory proteins |
| Proteomics | Identified by proteomics (see proteomics citations). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2156149 | 2156592 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1909c|furA
VSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP
Bibliography
- Wong DK, Lee BY, Horwitz MA and Gibson BW [1999]. Identification of fur, aconitase, and other proteins expressed by Mycobacterium tuberculosis under conditions of low and high concentrations of iron by combined two-dimensional gel electrophoresis and mass spectrometry. Proteomics Regulation
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Pym AS et al. [2001]. Regulation of catalase-peroxidase (KatG) expression, isoniazid sensitivity and virulence by furA of Mycobacterium tuberculosis. Regulation Mutant
- Milano A et al. [2001]. Transcriptional regulation of furA and katG upon oxidative stress in Mycobacterium smegmatis. Regulation
- Master S et al. [2001]. Mapping of Mycobacterium tuberculosis katG promoters and their differential expression in infected macrophages. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sala C et al. [2003]. Mycobacterium tuberculosis FurA autoregulates its own expression. Regulation
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant