Gene Mb1988 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | possible toxin vapc14 | 
| Comments | Mb1988, -, len: 103 aa. Equivalent to Rv1953, len: 103 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 103 aa overlap). Conserved hypothetical protein. Some similarity to O33827 PLASMID STABILITY-LIKE PROTEIN from Thiobacillus ferrooxidans (143 aa), FASTA scores: opt: 170, E(): 3.5e-06, (45.3% identity in 75 aa overlap). | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2192572 | 2192883 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1988|vapc14
MTYVLDTNVVSALRVPGRHPAVAAWADSVQVAEQFVVAITLAEIERGVIAKERTDPTQSEHLRRWFDDKVLRIFVFARRGTNLIMQPLAGHIGYSLYSGISWF
      
    Bibliography
    No article yet recorded