Gene Mb1988
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc14 |
| Comments | Mb1988, -, len: 103 aa. Equivalent to Rv1953, len: 103 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 103 aa overlap). Conserved hypothetical protein. Some similarity to O33827 PLASMID STABILITY-LIKE PROTEIN from Thiobacillus ferrooxidans (143 aa), FASTA scores: opt: 170, E(): 3.5e-06, (45.3% identity in 75 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2192572 | 2192883 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1988|vapc14
MTYVLDTNVVSALRVPGRHPAVAAWADSVQVAEQFVVAITLAEIERGVIAKERTDPTQSEHLRRWFDDKVLRIFVFARRGTNLIMQPLAGHIGYSLYSGISWF
Bibliography
No article yet recorded