Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC14
CommentsRv1953, (MTCY09F9.11c), len: 103 aa. Possible vapC14, toxin, part of toxin-antitoxin (TA) operon with Rv1952, contains PIN domain (See Arcus et al., 2005; Pandey and Gerdes, 2005). Some similarity to O33827 plasmid stability-like protein from Thiobacillus ferrooxidans (143 aa), FASTA scores: opt: 170, E(): 3.5e-06, (45.3% identity in 75 aa overlap).
Functional categoryVirulence, detoxification, adaptation
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22009382201249+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1953|vapC14
VTYVLDTNVVSALRVPGRHPAVAAWADSVQVAEQFVVAITLAEIERGVIAKERTDPTQSEHLRRWFDDKVLRIFVFARRGTNLIMQPLAGHIGYSLYSGISWF