Gene Mb1994c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin pare1 |
Comments | Mb1994c, -, len: 98 aa. Equivalent to Rv1959c, len: 98 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 98 aa overlap). Conserved hypothetical protein, similar to other hypothetical plasmid proteins e.g. AL117189|YPCD1.08 from Yersinia pestis (99 aa), FASTA scores: opt: 162, E(): 7.3e-05, (33.0% identity in 91 aa overlap); also some similarity to E145339 hypothetical protein (103 aa), FASTA scores: opt: 142, E(): 0.0003,(33.0% identity in 91 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2195315 | 2195611 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1994c|pare1 MSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEGTIDVVRVLHQRMDVDRNL
Bibliography
No article yet recorded