Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPossible toxin ParE1
CommentsRv1959c, (MTCY09F9.05), len: 98 aa. Possible parE1, toxin, part of toxin-antitoxin (TA) operon with Rv1960c (See Pandey and Gerdes, 2005), similar to other hypothetical plasmid proteins e.g. AL117189|YPCD1.08 from Yersinia pestis (99 aa), FASTA scores: opt: 162, E(): 7.3e-05, (33.0% identity in 91 aa overlap); also some similarity to E145339 hypothetical protein (103 aa), FASTA scores: opt: 142, E(): 0.0003, (33.0% identity in 91 aa overlap).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22036812203977-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1959c|parE1
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEGTIDVVRVLHQRMDVDRNL