Gene Mb2010
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable 23s rrna methyltransferase erm(37) |
Comments | Mb2010, -, len: 179 aa. Equivalent to Rv1988, len: 179 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 179 aa overlap). Probable methyltransferase (EC 2.1.1.-), similar to ERME_SACER|P07287 rrna adenine n-6-methyltransferase (370 aa), FASTA scores: opt: 259, E(): 2e-11, (35.1% identity in 171 aa overlap); contains PS00092 N-6 Adenine-specific DNA methylases signature. Also similar to Mycobacterium tuberculosis Rv1010 ksgA 16S rRNA dimethyltransferase. |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2210596 | 2211135 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2010|erm(37) MSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHLVRAGARVVAVELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANPPYGISSRLLRTLLAPNSGLVAADLVLQRALVCKFASRNARRFTLTVGLMLPRRAFLPPPHVDSAVLVVRRRKCGDWQGR
Bibliography
No article yet recorded