Gene Rv1988
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to cause methylation of 23S rRNA |
| Product | Probable 23S rRNA methyltransferase Erm(37) |
| Comments | Rv1988, (MTCY39.31c), len: 179 aa. Probable erm(37), 23S rRNA methyltransferase, similar to ERME_SACER|P07287 rrna adenine n-6-methyltransferase (370 aa), FASTA scores: opt: 259, E(): 2e-11, (35.1% identity in 171 aa overlap); contains PS00092 N-6 Adenine-specific DNA methylases signature. Also similar to Mycobacterium tuberculosis Rv1010 ksgA 16S rRNA dimethyltransferase. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2231680 | 2232219 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1988|erm(37)
VSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHLVRAGARVVAVELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANPPYGISSRLLRTLLAPNSGLVAADLVLQRALVCKFASRNARRFTLTVGLMLPRRAFLPPPHVDSAVLVVRRRKCGDWQGR
Bibliography
- Nash KA [2003]. Intrinsic macrolide resistance in Mycobacterium smegmatis is conferred by a novel erm gene, erm(38). Homolog Product Function
- Buriánková K et al. [2004]. Molecular basis of intrinsic macrolide resistance in the Mycobacterium tuberculosis complex. Function
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Madsen CT et al. [2005]. Methyltransferase Erm(37) slips on rRNA to confer atypical resistance in Mycobacterium tuberculosis. Function
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant