Gene Mb2063c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved transmembrane protein |
Comments | Mb2063c, -, len: 324 aa. Equivalent to Rv2037c,len: 324 aa, from Mycobacterium tuberculosis strain H37Rv,(99.7% identity in 324 aa overlap). Possible conserved transmembrane protein, similar to hypothetical proteins from Mycobacterium leprae MLCB2052.31 (329 aa) and Bacillus subtilis P54513|YQHO_BACSU (291 aa). FASTA scores: Z98604|MLCB2052_1 6 Mycobacterium leprae cosmid B205 (329 aa) opt: 1764, E(): 0; 80.5% identity in 323 aa overlap and sp|P54513|YQHO_BACSU HYPOTHETICAL 32.9 KD PROTEIN IN G (291 aa ) opt: 328, E(): 8.8e-14; 36.6% identity in 306 aa overlap. TBparse score is 0.919 |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2266660 | 2267634 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2063c|Mb2063c MALVSTARVDLVCEGGGVRGIGLVGAVDALADAGYRFPRVAGSSAGAIVASLVAALQTAGEPVTRLAEMMRSIDYPKFLDRNLIGHVPLIGGGLSLLLSDGVYRGAYLEQLLGGLLADLGVHTFGDLRTGEAPEQFAWSLVVTASDLSRRRLVRIPWDLDSYGIHPDDFSVARAVHASSAIPFVFEPVRVRGATWVDGGLLSNFPVALFDRTDAEPRWPTFGIRLSARPGIPPTRPVQGPVSLGIAAIETLVSNQDNAYIDDPCTVRRTIFVPAHDVSPIDFDITAEQREALYQRGFQAGQKFLANWNYADYLADCGGPFTPSL
Bibliography
No article yet recorded