Gene Mb2065c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable sugar-transport integral membrane protein ABC transporter |
| Comments | Mb2065c, -, len: 280 aa. Equivalent to Rv2039c,len: 280 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 280 aa overlap). Probable sugar-transport integral membrane protein ABC transporter (see citation below), equivalent to MLCB2052.29|Z98604|MLCB2052_14 from Mycobacterium leprae (283 aa), FASTA scores: opt: 1593, E(): 0, (79.2% identity in 283 aa overlap). Also similar to maltose and lactose transport proteins e.g. X66092|CPMALGHOM_1 from C. perfringens (275 aa), FASTA scores: opt: 695, E(): 0,(41.2% identity in 228 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature. Also contains possible helix-turn-helix motif at aa 171-192, although this is probably fortuitous. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2268712 | 2269554 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2065c|Mb2065c
MGWADRIVHRHFIRGLALYAGLIGIAWCALFPIIWALSGSLKADGEVTEPTLFPSHPQWSNYREVFALMPFWRMFFNTVLYAGCVTAGQVFFCSLAGYAFARLQFRGRDTLFVLYLSTLMVPLTVTVIPQFILMRIVGWVDTPWAMIVPGLFGSAFGTYLMRQFFRTLPTDLEEAAILDGCSPWQIYWRILLPHSRPAVLVLGVLTWVNVWNDFLWPLLMIQRNSLATLTLGLVRLRGEYVARWPVLMAASMLMLVPLVILYAVAQRSFVRGIAVTGLGG
Bibliography
No article yet recorded