Gene Mb2069c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pyrazinamidase/nicotinamidase pnca (pzase) |
| Comments | Mb2069c, pncA, len: 186 aa. Equivalent to Rv2043c,len: 186 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 186 aa overlap). pncA,pyrazinamidase/nicotinamidase (EC 3.5.1.-) (see citations below). Identical to PYRAZINAMIDASE/NICOTINAMIDASE involved in susceptibility or resistance to antituberculous drug pyrazinamide. FASTA scores: sptr|Q50575|Q50575 PYRAZINAMIDASE/NICOTINAMIDASE. (186 aa) opt: 1236, E(): 0; 100.0% identity in 186 aa overlap. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2272594 | 2273154 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2069c|pncA
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDDFSGTPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWLRQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASVELVCSS
Bibliography
No article yet recorded