Gene Rv2043c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Converts amides such as nicotinamide to corresponding acid. |
| Product | Pyrazinamidase/nicotinamidase PncA (PZase) |
| Comments | Rv2043c, (MTV018.30c), len: 186 aa. PncA, pyrazinamidase/nicotinamidase (see citations below), involved in susceptibility or resistance to antituberculous drug pyrazinamide. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2288681 | 2289241 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2043c|pncA
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSGTPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWLRQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASVELVCSS
Bibliography
- Scorpio A et al. [1996]. Mutations in pncA, a gene encoding pyrazinamidase/nicotinamidase, cause resistance to the antituberculous drug pyrazinamide in tubercle bacillus. Sequence Mutant
- Scorpio A et al. [1997]. Characterization of pncA mutations in pyrazinamide-resistant Mycobacterium tuberculosis. Mutant
- Hirano K et al. [1997]. Mutation in pncA is a major mechanism of pyrazinamide resistance in Mycobacterium tuberculosis. Clinical
- Sun Z et al. [1997]. The pncA gene from naturally pyrazinamide-resistant Mycobacterium avium encodes pyrazinamidase and confers pyrazinamide susceptibility to resistant M. tuberculosis complex organisms. Homolog Function
- Mestdagh M et al. [2000]. Correlation of pncA sequence with pyrazinamide resistance level in BACTEC for 21 mycobacterium tuberculosis clinical isolates. Clinical
- Du X et al. [2001]. Crystal structure and mechanism of catalysis of a pyrazinamidase from Pyrococcus horikoshii. Homolog Structure
- Lemaitre N et al. [2001]. Study of the structure-activity relationships for the pyrazinamidase (PncA) from Mycobacterium tuberculosis. Mutant Function Structure
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
