Gene Mb2121c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | sec-independent protein translocase membrane-bound protein tata |
| Comments | Mb2121c, tatA, len: 83 aa. Equivalent to Rv2094c,len: 83 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 83 aa overlap). Probable tatA,membrane-bound protein, component of twin-arginine translocation protein export system (see citation below for more information), equivalent to U00017_2 from Mycobacterium leprae (88 aa), FASTA scores: opt: 392, E(): 2e-20, (68.2% identity in 88 aa overlap). Similarity to others e.g. P27856|O65938|TATA_ECOLI SEC-INDEPENDENT PROTEIN TRANSLOCASE PROTEIN from E. coli strains K12 and O157:H7 (261 aa), FASTA scores: opt: 111, E(): 0.25, (28.0 % identity in 75 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop). BELONGS TO THE TATA/E FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2334889 | 2335140 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2121c|tatA
MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAEASIETPTPVQSQRVDPSAASGQDSTEARPA
Bibliography
No article yet recorded
