Gene Rv2094c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in protein export: required for correct localization of precursor proteins bearing signal peptides with the twin arginine conserved motif S/T-R-R-X-F-L-K. This sec-independent pathway is termed tat for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export. |
| Product | Sec-independent protein translocase membrane-bound protein TatA |
| Comments | Rv2094c, (MT2155, MTCY49.34c), len: 83 aa. TatA, membrane-bound protein, component of twin-arginine translocation protein export system (see Berks et al., 2000), similar to many. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the TATA/E family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 and hrcA|Rv2374c (see Stewart et al., 2002). |
| Regulon | Predicted to be in the SigE|Rv1221 regulon during macrophage (THP-1) infection (See Fontan et al., 2008). |
| Operon | pafC|Rv2095c and tatA|Rv2094c are co-transcribed, tatA|Rv2094c and tatC|Rv2093c are co-transcribed, but pafC|Rv2095c to tatC|Rv2093c are not, by RT-PCR (See Festa et al., 2007). |
| Mutant | Essential gene, determined by allelic exchange experiments (See Saint-Joanis et al., 2006). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2353046 | 2353297 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2094c|tatA
VGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAEASIETPTPVQSQRVDPSAASGQDSTEARPA
Bibliography
- Berks BC et al. [2000]. The Tat protein export pathway. Review
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Saint-Joanis B et al. [2006]. Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence. Mutant
- Festa RA et al. [2007]. Characterization of the proteasome accessory factor (paf) operon in Mycobacterium tuberculosis. Operon
- Fontán PA et al. [2008]. Mycobacterium tuberculosis sigma factor E regulon modulates the host inflammatory response. Regulon
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
