Gene Mb2152
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved transmembrane protein |
| Comments | Mb2152, -, len: 67 aa. Equivalent to Rv2128, len: 67 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 67 aa overlap). Probable conserved transmembrane protein. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2370483 | 2370686 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2152|Mb2152
MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDLS
Bibliography
No article yet recorded