Gene Rv2128
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Conserved transmembrane protein |
Comments | Rv2128, (MTCY26.27), len: 67 aa. Conserved transmembrane protein, similar to many. |
Functional category | Cell wall and cell processes |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2390085 | 2390288 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv2128|2390085-2390288|+|Rv2128|downstream:0|upstream:0 atgcttcgaagaggtgaatcgatcatccgcaaccgttacgccagtaagccaccactgtacggaatggcaatggtcttcttggccatggccgtcgtcgccgtgaccgcgtactttcgcatgggctggtggtcgatcatcggttacgccgccgctgccattatcggagtgatcgggttcgcactcgccttccgcgacctgtcctga
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2128|Rv2128 MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDLS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant