Gene Mb2159c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2159c, -, len: 236 aa. Equivalent to Rv2135c,len: 236 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 236 aa overlap). Conserved hypothetical protein. Function: unknown but equivalent to hypothetical Mycobacterium leprae protein, Q49773. FASTA best: Q49773 B2126_C1_148 opt: 1183, E() : 0; (74.8% identity in 250 aa overlap), also similar in C-terminus to PMG2_ECOLI P36942 probable phosphoglycerate mutase 2 (215 aa), FASTA scores; opt: 212, E(): 2.5e-07 27.9% identity in 190 aa overlap; and to Rv2228 and Rv2419c |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2375699 | 2376409 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2159c|Mb2159c
MTVILLRHARSTSNTAGVLAGRSGVDLDEKGREQATGLIDRIGDLPIRAVASSPMLRCQRTVEPLAEALCLEPLIDDRFSEVDYGEWTGRKIGDLVDEPLWRVVQAHPSAAVFPGGEGLAQVQTRAVAAVREHDRRLADQHGHDVLWLACTHGDVIKAVIADAFGMHLDSFQRITADPGSVSVVRYTQLRPFVLHVNHTGARLAPALQAAASAQGASPEPNAAVPPGDAVIGGSTD
Bibliography
No article yet recorded