Gene Mb2204c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 1-acylglycerol-3-phosphate O-acyltransferase |
| Comments | Mb2204c, -, len: 247 aa. Equivalent to Rv2182c,len: 247 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 247 aa overlap). Probable 1-acylglycerol-3-phosphate O-acyltransferase, similar to many e.g. in Streptomyces. Contains PS00017 ATP/GTP-binding site motif A (P-loop). FASTA scores: pir||T35503 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) homolog SC6E10.16c - Streptomyces coelicolor >gi|5689932|emb|CAB51970.1| (AL109661) hypothetical protein [Streptomyces coelicolor A3(2)] Length = 262,Expect = 6e-61 (54% identity in 215 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2423620 | 2424363 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2204c|Mb2204c
MWYYLFKYIFMGPLFTLLGRPKVEGLEYIPSSGPAILASNHLAVADSFYLPLVVRRRIWFLAKSEYFTGTGLKGWINRWFYSVSGQVPIDRTNADSAQGALQTAVVLLGQGKLLGMYPEGTRSPDGRLYKGKTGLARLALHTGVPVIPVAMIGTNVVNPPGRKMLRFGRVTVRFGKPMDFSRFEGLAGNHFIERAVTDEVIYELMGLSGQEYVDIYAASVKDGRNAGGAGANPNSTDAARIPETAAG
Bibliography
No article yet recorded