Gene Mb2256A
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Possible toxin VapC16 |
Comments | Mb2256A, len: 141 aa. Equivalent to Rv2231A len: 141 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 141 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Possible vapC16, toxin, part of toxin-antitoxin (TA) operon with Rv2231B (See Pandey and Gerdes, 2005). Nucleotide position 2505919 in the genome sequence has been corrected, A:G resulting in A81A. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2484884 | 2485309 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2256A|vapC16 MTMACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHRPGTAAWPDDHHRRRPVSCL
Bibliography
No article yet recorded