Gene Rv2231A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible toxin VapC16 |
| Comments | Rv2231A, len: 141 aa. Possible vapC16, toxin, part of toxin-antitoxin (TA) operon with Rv2231B (See Pandey and Gerdes, 2005). Nucleotide position 2505919 in the genome sequence has been corrected, A:G resulting in A81A. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2505736 | 2506161 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2231A|vapC16
LTMACTACPTIWTLRCQTTCSNAFTGEALPHRHPRLAADAVNETRAIVQDVRNSILLSAASAWEIAINYRLGKLPPPEPSASYVPDRMRRCGTSPLSVDHAHTAHRRASGSPSTSIRPCAHRPGTAAWPDDHHRRRPVSCL
Bibliography
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G and Archer JA [2009]. Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints. Sequence
- Ioerger TR et al. [2010]. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
