Gene Mb2324
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2324, -, len: 80 aa. Equivalent to Rv2302, len: 80 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 80 aa overlap). Conserved hypothetical protein, highly similar to others: O53766|AL021942|Rv0569|MTV039.07 HYPOTHETICAL 9.5 KDA PROTEIN from Mycobacterium tuberculosis (88 aa), FASTA scores: opt: 300, E(): 1.4e-14, (61.85% identity in 76 aa overlap); O88049|SCI35.11 HYPOTHETICAL 7.1 KDA PROTEIN from Streptomyces coelicolor (64 aa), FASTA scores: opt: 169, E(): 1.5e-05, (46.55% identity in 58 aa overlap) (has its C-terminus shorter); Q9XCD1 HYPOTHETICAL 12.0 KDA PROTEIN (FRAGMENT) from Thermomonospora fusca (106 aa),FASTA scores: opt: 126, E(): 0.023, (50.0% identity in 34 aa overlap) (similarity in part for this one). Also weakly similar to U650M|G699303|Q50105 HYPOTHETICAL 5.7 KDA PROTEIN from Mycobacterium leprae (53 aa), FASTA scores: opt: 89, E(): 0.66, (45.5% identity in 33 aa overlap); and weakly similar to N-terminus of Q9RIZ1|SCJ1.23c putative DNA-binding protein from Streptomyces coelicolor (323 aa),FASTA scores: opt: 182, E(): 7.3e-06, (42.25% identity in 71 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2551408 | 2551650 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2324|Mb2324
MHAKVGDYLVVKGTTTERHDQHAEIIEVRSADGSPPYVVRWLVNGHETTVYPGSDAVVVTATEHAEAEKRAAARAGHAAT
Bibliography
No article yet recorded
