Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv2302, (MTCY339.07c), len: 80 aa. Conserved protein, highly similar to others: O53766|AL021942|Rv0569|MTV039.07 hypothetical 9.5 KDA protein from Mycobacterium tuberculosis (88 aa), FASTA scores: opt: 300, E(): 1.4e-14, (61.85% identity in 76 aa overlap); O88049|SCI35.11 hypothetical 7.1 KDA protein from Streptomyces coelicolor (64 aa), FASTA scores: opt: 169, E(): 1.5e-05, (46.55% identity in 58 aa overlap) (has its C-terminus shorter); Q9XCD1 hypothetical 12.0 KDA protein (fragment) from Thermomonospora fusca (106 aa), FASTA scores: opt: 126, E(): 0.023, (50.0% identity in 34 aa overlap) (similarity in part for this one). Also weakly similar to U650M|G699303|Q50105 hypothetical 5.7 KDA protein from Mycobacterium leprae (53 aa), FASTA scores: opt: 89, E(): 0.66, (45.5% identity in 33 aa overlap); and weakly similar to N-terminus of Q9RIZ1|SCJ1.23c putative DNA-binding protein from Streptomyces coelicolor (323 aa), FASTA scores: opt: 182, E(): 7.3e-06, (42.25% identity in 71 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis: possibly down-regulated by hrcA|Rv2374c, and up-regulated after 96h of starvation (see citations below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS25738132574055+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2302|Rv2302
MHAKVGDYLVVKGTTTERHDQHAEIIEVRSADGSPPYVVRWLVNGHETTVYPGSDAVVVTATEHAEAEKRAAARAGHAAT
      
Bibliography