Gene Mb2330c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb2330c, -, len: 281 aa. Equivalent to Rv2307c,len: 281 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 281 aa overlap). Conserved hypothetical protein, similar to many other hypothetical proteins and BEM1/BUD5 suppressors e.g. P77538 HYPOTHETICAL PROTEIN from Escherichia coli (293 aa), FASTA scores: opt: 421,E(): 2.4e-18, (32.1% identity in 268 aa overlap) (alias AAG57647|Z3802|BAB36823|ECS3400 Putative enzyme (3.4.-) from Escherichia coli (293 aa), FASTA scores: opt: 425,E(): 1.7e-18, (32.1% identity in 268 aa overlap));P54069|BE46_SCHPO|BEM46|SPBC32H8.03|PI020 BEM46 PROTEIN from Schizosaccharomyces pombe (Fission yeast) (352 aa), FASTA scores: opt: 355, E(): 3.3e-14, (30.45% identity in 279 aa overlap); O76462|BEM46 BEM46 PROTEIN from Drosophila melanogaster (338 aa), FASTA scores: opt: 404, E(): 2.8e-17, (32.75% identity in 281 aa overlap); etc. Equivalent (but with few differences) to AAK46650|MT2364 protein from Mycobacterium tuberculosis strain CDC1551 (281 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2555446 | 2556291 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2330c|Mb2330c
MSLKRCRALPVVAIVALVASGVITFIWSQQRRLIYFPSAGPVPSASSVLPAGRDVVVETQDGMRLGGWYFPHTSGGSGPAVLVCNGNAGDRSMRAELAVALHGLGLSVLLFDYRGYGGNPGRPSEQGLAADARAAQEWLSGQSDVDPARIAYFGESLGAAVAVGLAVQRPPAALVLRSPFTSLAEVGAVHYPWLPLRRLLLDHYPSIERIASVHAPVLVIAGGSDDIVPATLSEWLVAAAAEPKRYVVVPGVGHNDPELLDGRVMLDAIRRFLTETAVLGQ
Bibliography
No article yet recorded