Gene Mb2383c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible dna repair protein reco |
| Comments | Mb2383c, -, len: 265 aa. Equivalent to Rv2362c,len: 265 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 265 aa overlap). Conserved hypothetical protein, equivalent to the Mycobacterium leprae proteins Q49754|B1937_F1_25 Hypothetical protein (269 aa), FASTA scores: opt: 1561, E(): 8.5e-93, (86.6% identity in 268 aa overlap); and Q9CCN0|ML0633 Hypothetical protein (268 aa), FASTA scores: opt: 1560,E(): 8.5e-93, (86.6% identity in 268 aa overlap). Also highly similar to Q9L2H3|SCC121.13c HYPOTHETICAL 27.1 KDA PROTEIN from Streptomyces coelicolor (251 aa), FASTA scores: opt: 843, E(): 6.9e-47, (52.2% identity in 249 aa overlap); ans similar to other hypothetical proteins. Weak similarity with P42095|RECO_BACSU DNA REPAIR PROTEIN RECOMBINASE from Bacillus subtilis (255 aa), FASTA scores: opt: 270, E(): 3.6e-10, (26.4% identity in 182 aa overlap). |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2611532 | 2612329 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2383c|reco
MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTRSKFGARLEPFAHIEVQLHPGRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERLAGEERAPAPALHRLTVGALRAVADGQRPRDLLLDAYLLRAMGIAGWAPALTECARCATPGPHRAFHIATGGSVCAHCRPAGSTTPPLGVVDLMSALYDGDWEAAEAAPQSARSHVSGLVAAHLQWHLERQLKTLPLVERFYQADRSVAERRAALIGQDIAGG
Bibliography
No article yet recorded
