Gene Mb2388c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | Mb2388c, -, len: 182 aa. Equivalent to Rv2367c,len: 182 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 182 aa overlap). Conserved hypothetical protein, equivalent to Q49752|YN67_MYCLE|ML0628|B1937_F1_21 HYPOTHETICAL 19.8 KDA PROTEIN from Mycobacterium leprae (178 aa), FASTA scores: opt: 1051, E(): 2e-59, (89.1% identity in 175 aa overlap). Also highly similar to others e.g. Q9L2L4|SCC117.06 CONSERVED HYPOTHETICAL PROTEIN from Streptomyces coelicolor (165 aa), FASTA scores: opt: 599, E(): 6e-31,(56.5% identity in 154 aa overlap); Q9KD56|BH1363 HYPOTHETICAL PROTEIN from Bacillus halodurans (159 aa),FASTA scores: opt: 311, E(): 8.3e-13, (45.05% identity in 111 aa overlap); etc. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2616435 | 2616983 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2388c|Mb2388c MREHLMSIEVANESGIDVSEAELVSVARFVIAKMDVNPCAELSMLLLDTAAMADLHMRWMDLPGPTDVMSFPMDELEPGGRPDAPEPGPSMLGDIVLCPEFAAEQAAAAGHSLGHELALLTIHGVLHLLGYDHAEPDEEKEMFALQDRLLEEWVADQVEAYQHDRQDEKDRRLLDKSRYFDL
Bibliography
No article yet recorded