Gene Mb2406
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PUTATIVE ACETYL HYDROLASE MBTJ |
| Comments | Mb2406, mbtJ, len: 306 aa. Equivalent to Rv2385,len: 306 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 306 aa overlap). Putative mbtJ, acetyl hydrolase (EC 3.1.1.-) (see citations below), showing some similarity with various hydrolases including acetyl hydrolases e.g. Q9ZBM4|MLCB1450.08|ML0314 PUTATIVE HYDROLASE/ESTERASE from Mycobacterium leprae (335 aa),FASTA scores: opt: 449, E(): 6.7e-21, (33.85% identity in 313 aa overlap); AAK47950|MT3591 Esterase from M. tuberculosis strain CDC1551 (327 aa), FASTA scores: opt: 469, E(): 3.6e-22, (35% identity in 283 aa overlap); Q9X8J4|SCE9.22 PUTATIVE ESTERASE from Streptomyces coelicolor (266 aa), FASTA scores: opt: 430,E(): 8.5e-20,(38% identity in 245 aa overlap); Q01109|BAH_STRHY ACETYL-HYDROLASE (EC 3.1.1.-) from Streptomyces hygroscopicus (299 aa), FASTA scores: opt: 420, E(): 4e-19, (35.1% identity in 265 aa overlap). Equivalent to AAK46748 from Mycobacterium tuberculosis strain CDC1551 (327 aa) but shorter 21 aa. Note that previously known as lipK. |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2645800 | 2646720 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2406|mbtJ
MVLRPITGAIPPDGPWGIWASRRIIAGLMGTFGPSLAGTRVEQVNSVLPDGRRVVGEWVYGPHNNAINAGPGGGAIYYVHGSGYTMCSPRTHRRLTSWLSSLTGLPVFSVDYRLAPRYRFPTAATDVRAAWDWLAHVCGLAAEHMVIAADSAGGHLTVDMLLQPEVAARPPAAVVLFSPLIDLTFRLGASRELQRPDPVVRADRAARSVALYYTGVDPAHHRLALDVAGGPPLPPTLIQVGGAEILEADARQLDADIRAAGGICELQVWPDQMHVFQALPRMTPEAAKAMTYVAQFIRSTTARGDL
Bibliography
No article yet recorded