Gene Rv2385 (lipK)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the biogenesis of the hydroxyphenyloxazoline-containing siderophore mycobactins. Possibly required for N-hydroxylation of the two lysine residues at some stage during mycobactin assembly. |
| Product | Putative acetyl hydrolase MbtJ |
| Comments | Rv2385, (MTCY253.36c), len: 306 aa. Putative mbtJ, acetyl hydrolase (see citations below), showing some similarity with various hydrolases including acetyl hydrolases e.g. Q9ZBM4|MLCB1450.08|ML0314 putative hydrolase/esterase from Mycobacterium leprae (335 aa), FASTA scores: opt: 449, E(): 6.7e-21, (33.85% identity in 313 aa overlap); AAK47950|MT3591 Esterase from M. tuberculosis strain CDC1551 (327 aa), FASTA scores: opt: 469, E(): 3.6e-22, (35% identity in 283 aa overlap); Q9X8J4|SCE9.22 putative esterase from Streptomyces coelicolor (266 aa), FASTA scores: opt: 430,E(): 8.5e-20, (38% identity in 245 aa overlap); Q01109|BAH_STRHY acetyl-hydrolase from Streptomyces hygroscopicus (299 aa), FASTA scores: opt: 420, E(): 4e-19, (35.1% identity in 265 aa overlap). Equivalent to AAK46748 from Mycobacterium tuberculosis strain CDC1551 (327 aa) but shorter 21 aa. Note that previously known as lipK. |
| Functional category | Lipid metabolism |
| Transcriptomics | DNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2677729 | 2678649 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2385|mbtJ
MVLRPITGAIPPDGPWGIWASRRIIAGLMGTFGPSLAGTRVEQVNSVLPDGRRVVGEWVYGPHNNAINAGPGGGAIYYVHGSGYTMCSPRTHRRLTSWLSSLTGLPVFSVDYRLAPRYRFPTAATDVRAAWDWLAHVCGLAAEHMVIAADSAGGHLTVDMLLQPEVAARPPAAVVLFSPLIDLTFRLGASRELQRPDPVVRADRAARSVALYYTGVDPAHHRLALDVAGGPPLPPTLIQVGGAEILEADARQLDADIRAAGGICELQVWPDQMHVFQALPRMTPEAAKAMTYVAQFIRSTTARGDL
Bibliography
- Quadri LE et al. [1998]. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Secondary Function
- De Voss JJ et al. [1999]. Iron acquisition and metabolism by mycobacteria. Review
- Rodriguez GM, Voskuil MI, Gold B, Schoolnik GK and Smith I [2002]. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Deb C, Daniel J, Sirakova TD, Abomoelak B, Dubey VS and Kolattukudy PE [2006]. A novel lipase belonging to the hormone-sensitive lipase family induced under starvation to utilize stored triacylglycerol in Mycobacterium tuberculosis. Product Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
