Gene Mb2413
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable 3'-phosphoadenosine 5'-phosphosulfate reductase cysh (paps reductase, thioredoxin dep.) (padops reductase) (3'-phosphoadenylylsulfate reductase) (paps sulfotransferase) |
| Comments | Mb2413, cysH, len: 254 aa. Equivalent to Rv2392,len: 254 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 254 aa overlap). Probable cysH,3'-phosphoadenosine 5'-phosphosulfate reductase (EC 1.8.4.8), similar to many e.g. P94498|O34620|CYH1_BACSU|CYSH from Bacillus subtilis (233 aa), FASTA scores: opt: 618, E(): 8.1e-32, (46.5% identity in 202 aa overlap); Q9KCT3|CYSH|BH1486 from Bacillus halodurans (231 aa), FASTA scores: opt: 560, E(): 3.6e-28,(41.3% identity in 230 aa overlap); P56860|CYSH_DEIRA from Deinococcus radiodurans (255 aa), FASTA scores: opt: 489,E(): 1.1e-23, (44.7% identity in 190 aa overlap); etc. BELONGS TO THE PAPS REDUCTASE FAMILY and CYSH SUBFAMILY. Note that operon cysA-cysW-cysT-subI, probably involved in sulfate transport, is near this putative ORF. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2654438 | 2655202 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2413|cysH
MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAGGGVSGHRGWTTCNYVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESVYDVRVLNVTPEHTVAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGYSAWVTGLRRVDAPTRANAPLVSFDETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLVREGYPSIGCAPCTAKPAEGADPRSGRWQGLAKTECGLHAS
Bibliography
No article yet recorded
