Gene Mb2417A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Acid and phagosome regulated protein A AprA |
| Comments | Mb2417A, len: 71 aa. Equivalent to Rv2395A len: 71 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 71 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). AprA, acid and phagosome regulated protein A, restricted to M. tuberculosis complex. Note completely overlapped by sRNA mcr7. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2660296 | 2660511 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2417A|aprA
MTMTASVAKVTAARPEPSAAWAEARRRVRQRREDMLRHPAFLSKQLPAEPADDDGVAAVYDIAIARRRRPA
Bibliography
No article yet recorded