Gene Mb2417A 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Acid and phagosome regulated protein A AprA | 
| Comments | Mb2417A, len: 71 aa. Equivalent to Rv2395A len: 71 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 71 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). AprA, acid and phagosome regulated protein A, restricted to M. tuberculosis complex. Note completely overlapped by sRNA mcr7. | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2660296 | 2660511 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb2417A|aprA
MTMTASVAKVTAARPEPSAAWAEARRRVRQRREDMLRHPAFLSKQLPAEPADDDGVAAVYDIAIARRRRPA
      
    Bibliography
    No article yet recorded