Gene Rv2395A
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Acid and phagosome regulated protein A AprA |
Comments | Rv2395A, len: 71 aa. AprA, acid and phagosome regulated protein A, restricted to M. tuberculosis complex. Note completely overlapped by sRNA mcr7. |
Functional category | Conserved hypotheticals |
Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2692224 | 2692439 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2395A|aprA LTMTASVAKVTAARPEPSAAWAEARRRVRQRREDMLRHPAFLSKQLPAEPADDDGVAAVYDIAIARRRRPA
Bibliography
- Abramovitch RB et al. [2011]. aprABC: a Mycobacterium tuberculosis complex-specific locus that modulates pH-driven adaptation to the macrophage phagosome. Regulation
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant