Gene Mb2417B
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Acid and phagosome regulated protein B AprB |
| Comments | Mb2417B, len: 54 aa. Equivalent to Rv2395B len: 54 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 54 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). AprB, acid and phagosome regulated protein B, restricted to M. tuberculosis complex. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2660623 | 2660787 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2417B|aprB
MPGLVPAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL
Bibliography
No article yet recorded