Gene Rv2395B
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Acid and phagosome regulated protein B AprB |
Comments | Rv2395B, len: 54 aa. AprB, acid and phagosome regulated protein B, restricted to M. tuberculosis complex. |
Functional category | Conserved hypotheticals |
Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2692551 | 2692715 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2395B|aprB VPGLVPAMPLDALRPARQPTSGLGECATMRRPEAGNEKVAVIWESLDVVPPESL
Bibliography
- Abramovitch RB et al. [2011]. aprABC: a Mycobacterium tuberculosis complex-specific locus that modulates pH-driven adaptation to the macrophage phagosome. Regulation
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant