Gene Mb2428
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2428, -, len: 189 aa. Equivalent to Rv2405, len: 189 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 189 aa overlap). Conserved hypothetical protein, identical (but N-terminus longer 40 residues) to AAK46773|MT2477 HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis strain CDC1551. Also highly similar, but N-terminus longer 38 residues, to Q9RD03|SCCM1.41 HYPOTHETICAL 17.4 KDA PROTEIN from Streptomyces coelicolor (154 aa), FASTA scores: opt: 451,E(): 2e-22, (48.7% identity in 154 aa overlap). Shows also similarity with hypothetical proteins from other species. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2671338 | 2671907 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2428|Mb2428 MQRFAENLVFTEAPKLVRHLQNTQETLRTIRQAVKITANIMTTAVPSPPAEIAAGRPVTSTSCPTAARARRLVYAPDLDGRADPGEIVWTWVAYEQDPTRGKDRPVLVVGRDRSVLLGLLVSSQERHAADRDWVGIGSGAWDYEGRESWVRLDRVLDVPEESIRREGAILEREVFDVVAARLRADYAWR
Bibliography
No article yet recorded