Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv2405, (MTCY253.15c), len: 189 aa. Conserved protein, identical (but N-terminus longer 40 residues) to AAK46773|MT2477 hypothetical protein from Mycobacterium tuberculosis strain CDC1551. Also highly similar, but N-terminus longer 38 residues, to Q9RD03|SCCM1.41 hypothetical 17.4 KDA protein from Streptomyces coelicolor (154 aa), FASTA scores: opt: 451, E(): 2e-22, (48.7% identity in 154 aa overlap). Shows also similarity with hypothetical proteins from other species.
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27032692703838+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2405|Rv2405
LQRFAENLVFTEAPKLVRHLQNTQETLRTIRQAVKITANIMTTAVPSPPAEIAAGRPVTSTSCPTAARARRLVYAPDLDGRADPGEIVWTWVAYEQDPTRGKDRPVLVVGRDRSVLLGLLVSSQERHAADRDWVGIGSGAWDYEGRESWVRLDRVLDVPEESIRREGAILEREVFDVVAARLRADYAWR