Gene Mb2430
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | Mb2430, -, len: 280 aa. Equivalent to Rv2407, len: 273 aa, from Mycobacterium tuberculosis strain H37Rv,(97.5% identity in 280 aa overlap). Conserved hypothetical protein, highly similar (but longer at N-terminus) to AAK46775|MT2479 putative arylsulfatase from Mycobacterium tuberculosis strain CDC1551 (224 aa) FASTA scores: opt: 1433, E(): 2.5e-81, (96.43% identity in 224 aa overlap); O33130|MLCL536.01 HYPOTHETICAL PROTEIN from Mycobacterium leprae (220 aa), FASTA scores: opt: 658, E(): 1.5e-33,(56.75% identity in 215 aa overlap). Also similar to AAK23160|CC1176 Metallo-beta-lactamase family protein from Caulobacter crescentus (317 aa), FASTA scores: opt: 286,E(): 1.8e-10, (33% identity in 291 aa overlap). And similar to other hypothetical proteins eg Q49744|B1937_C1_163 HYPOTHETICAL 22.6 KDA PROTEIN (PRECURSOR) from Mycobacterium leprae (211 aa), FASTA scores: opt: 623, E(): 2.1e-31, (56.3% identity in 206 aa overlap); O27859|MTH1831 CONSERVED PROTEIN from Methanothermobacter thermautotrophicus (307 aa), FASTA scores: opt: 268, E(): 2.3e-09, (28.35% identity in 307 aa overlap); etc. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 21 bp in-frame insertion leads to a longer product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (280 aa versus 273 aa). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2672766 | 2673608 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2430|Mb2430 MLEITLLGTGSPIPDPDRAGPSTLVRAGAQAFLVDCGRGVLQRAAAVGVGAAGLSAVLLTHLHSDHIAELGDVLITSWVTNFAADPAPLPIIGPPGTAEVVEATLKAFGHDIGYRIAHHADLTTPPPIEVHEYTAGPAWDRDGVTIRVAPTDHRPVTPTIGFRIESDGASVVLAGDTVPCDSLDQLAAGADALVHTVIRKDIVTQIPQQRVKDICDYHSSVQEAAATANRAGVGTLVMTHYVPAIGPGQEEQWRALAATEFSGRIEVGNDLHRVEVHPRR
Bibliography
No article yet recorded