Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2407, (MTCY253.13c), len: 273 aa. Conserved hypothetical protein, highly similar (but longer at N-terminus) to AAK46775|MT2479 putative arylsulfatase from Mycobacterium tuberculosis strain CDC1551 (224 aa) FASTA scores: opt: 1433, E(): 2.5e-81, (96.43% identity in 224 aa overlap); O33130|MLCL536.01 hypothetical protein from Mycobacterium leprae (220 aa), FASTA scores: opt: 658, E(): 1.5e-33, (56.75% identity in 215 aa overlap). Also similar to AAK23160|CC1176 Metallo-beta-lactamase family protein from Caulobacter crescentus (317 aa), FASTA scores: opt: 286, E(): 1.8e-10, (33% identity in 291 aa overlap). And similar to other hypothetical proteins eg Q49744|B1937_C1_163 hypothetical 22.6 KDA protein (precursor) from Mycobacterium leprae (211 aa), FASTA scores: opt: 623, E(): 2.1e-31, (56.3% identity in 206 aa overlap); O27859|MTH1831 conserved protein from Methanothermobacter thermautotrophicus (307 aa), FASTA scores: opt: 268, E(): 2.3e-09, (28.35% identity in 307 aa overlap); etc.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27046972705518+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2407|Rv2407
MLEITLLGTGSPIPDPDRAGPSTLVRAGAQAFLVDCGRGVLQRAAAVGVGAAGLSAVLLTHLHGDVLITSWVTNFAADPAPLPIIGPPGTAEVVEATLKAFGHDIGYRIAHHADLTTPPPIEVHEYTAGPAWDRDGVTIRVAPTDHRPVTPTIGFRIESDGASVVLAGDTVPCDSLDQLAAGADALVHTVIRKDIVTQIPQQRVKDICDYHSSVQEAAATANRAGVGTLVMTHYVPAIGPGQEEQWRALAATEFSGRIEVGNDLHRVEVHPRR