Gene Rv2407
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2407, (MTCY253.13c), len: 273 aa. Conserved hypothetical protein, highly similar (but longer at N-terminus) to AAK46775|MT2479 putative arylsulfatase from Mycobacterium tuberculosis strain CDC1551 (224 aa) FASTA scores: opt: 1433, E(): 2.5e-81, (96.43% identity in 224 aa overlap); O33130|MLCL536.01 hypothetical protein from Mycobacterium leprae (220 aa), FASTA scores: opt: 658, E(): 1.5e-33, (56.75% identity in 215 aa overlap). Also similar to AAK23160|CC1176 Metallo-beta-lactamase family protein from Caulobacter crescentus (317 aa), FASTA scores: opt: 286, E(): 1.8e-10, (33% identity in 291 aa overlap). And similar to other hypothetical proteins eg Q49744|B1937_C1_163 hypothetical 22.6 KDA protein (precursor) from Mycobacterium leprae (211 aa), FASTA scores: opt: 623, E(): 2.1e-31, (56.3% identity in 206 aa overlap); O27859|MTH1831 conserved protein from Methanothermobacter thermautotrophicus (307 aa), FASTA scores: opt: 268, E(): 2.3e-09, (28.35% identity in 307 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2704697 | 2705518 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2407|Rv2407
MLEITLLGTGSPIPDPDRAGPSTLVRAGAQAFLVDCGRGVLQRAAAVGVGAAGLSAVLLTHLHGDVLITSWVTNFAADPAPLPIIGPPGTAEVVEATLKAFGHDIGYRIAHHADLTTPPPIEVHEYTAGPAWDRDGVTIRVAPTDHRPVTPTIGFRIESDGASVVLAGDTVPCDSLDQLAAGADALVHTVIRKDIVTQIPQQRVKDICDYHSSVQEAAATANRAGVGTLVMTHYVPAIGPGQEEQWRALAATEFSGRIEVGNDLHRVEVHPRR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
