Gene Mb2435
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 30s ribosomal protein s20 rpst |
| Comments | Mb2435, rpsT, len: 86 aa. Equivalent to Rv2412,len: 86 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 86 aa overlap). Probable rpsT, 30s ribosomal protein s20, equivalent to O33132|RS20_MYCLE|L0604|MLCL536.06 30S RIBOSOMAL PROTEIN S20 from Mycobacterium leprae (86 aa), FASTA scores: opt: 456, E(): 4.6e-24, (87.20% identity in 86 aa overlap). Also highly similar or similar to others e.g. Q9RDM3|RPST|SCC123.01 30S RIBOSOMAL PROTEIN S20 from Streptomyces coelicolor (88 aa), FASTA scores: opt: 363,E(): 7.1e-18, (70.95% identity in 86 aa overlap); Q9KD79|RPST|BH1339 RIBOSOMAL PROTEIN S20 (BS20) from Bacillus halodurans (91 aa), FASTA scores: opt: 252, E(): 1.8e-10, (49.4% identity in 85 aa overlap); P02378|RS20_ECOLI 30s ribosomal protein s20 from Escherichia coli (86 aa), FASTA scores: opt: 210, E(): 1e-07, (42.4% identity in 85 aa overlap); etc. BELONGS TO THE S20P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2678259 | 2678519 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2435|rpsT
MANIKSQQKRNRTNERARLRNKAVKSSLRTAVRAFREAAHAGDKAKAAELLASTNRKLDKAASKGVIHKNQAANKKSALAQALNKL
Bibliography
No article yet recorded
