Gene Mb2539
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | oligoribonuclease orn |
| Comments | Mb2539, orn, len: 215 aa. Equivalent to Rv2511,len: 215 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 215 aa overlap). Probable orn,oligoribonuclease (EC 3.1.-.-), equivalent to O07708|ORN_MYCLE|ORN|ML0427|MLCL383.34c OLIGORIBONUCLEASE from Mycobacterium leprae (215 aa), FASTA scores: opt: 1170, E(): 3.5e-65, (84.5% identity in 213 aa overlap). Also highly similar to many e.g. P57667|ORN_STRGR|ORNA from Streptomyces griseus (201 aa), FASTA scores: opt: 807, E(): 7.7e-43, (59.0% identity in 200 aa overlap); ORN_STRCO|ORNA|2SC13.01 from Streptomyces coelicolor (200 aa), FASTA scores: opt: 799, E(): 2.4e-42, (59.7% identity in 201 aa overlap); P39287|ORN_ECOLI|B4162 from Escherichia coli strain K12 (180 aa), FASTA scores: opt: 519, E(): 3.9e-25, (47.4% identity in 173 aa overlap); etc. BELONGS TO THE OLIGORIBONUCLEASE FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2793954 | 2794601 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2539|orn
MQDELVWIDCEMTGLDLGSDKLIEIAALVTDADLNILGDGVDVVMHADDAALSGMIDVVAEMHSRSGLIDEVKASTVDLATAEAMVLDYINEHVKQPKTAPLAGNSIATDRAFIARDMPTLDSFLHYRMIDVSSIKELCRRWYPRIYFGQPPKGLTHRALADIHESIRELRFYRRTAFVPQPGPSTSEIAAVVAELSDGAGAQEETDSAEAPQSG
Bibliography
No article yet recorded
