Gene Rv2511
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in RNA degradation: 3'-to-5' exoribonuclease specific for small oligoribonucleotides. |
| Product | Oligoribonuclease Orn |
| Comments | Rv2511, (MTCY07A7.17), len: 215 aa. Orn, oligoribonuclease, equivalent to O07708|ORN_MYCLE|ORN|ML0427|MLCL383.34c oligoribonuclease from Mycobacterium leprae (215 aa), FASTA scores: opt: 1170, E(): 3.5e-65, (84.5% identity in 213 aa overlap). Also highly similar to many e.g. P57667|ORN_STRGR|ORNA from Streptomyces griseus (201 aa), FASTA scores: opt: 807, E(): 7.7e-43, (59.0% identity in 200 aa overlap); ORN_STRCO|ORNA|2SC13.01 from Streptomyces coelicolor (200 aa), FASTA scores: opt: 799, E(): 2.4e-42, (59.7% identity in 201 aa overlap); P39287|ORN_ECOLI|B4162 from Escherichia coli strain K12 (180 aa), FASTA scores: opt: 519, E(): 3.9e-25, (47.4% identity in 173 aa overlap); etc. Belongs to the oligoribonuclease family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2827157 | 2827804 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2511|orn
VQDELVWIDCEMTGLDLGSDKLIEIAALVTDADLNILGDGVDVVMHADDAALSGMIDVVAEMHSRSGLIDEVKASTVDLATAEAMVLDYINEHVKQPKTAPLAGNSIATDRAFIARDMPTLDSFLHYRMIDVSSIKELCRRWYPRIYFGQPPKGLTHRALADIHESIRELRFYRRTAFVPQPGPSTSEIAAVVAELSDGAGAQEETDSAEAPQSG
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
