Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in RNA degradation: 3'-to-5' exoribonuclease specific for small oligoribonucleotides.
ProductOligoribonuclease Orn
CommentsRv2511, (MTCY07A7.17), len: 215 aa. Orn, oligoribonuclease, equivalent to O07708|ORN_MYCLE|ORN|ML0427|MLCL383.34c oligoribonuclease from Mycobacterium leprae (215 aa), FASTA scores: opt: 1170, E(): 3.5e-65, (84.5% identity in 213 aa overlap). Also highly similar to many e.g. P57667|ORN_STRGR|ORNA from Streptomyces griseus (201 aa), FASTA scores: opt: 807, E(): 7.7e-43, (59.0% identity in 200 aa overlap); ORN_STRCO|ORNA|2SC13.01 from Streptomyces coelicolor (200 aa), FASTA scores: opt: 799, E(): 2.4e-42, (59.7% identity in 201 aa overlap); P39287|ORN_ECOLI|B4162 from Escherichia coli strain K12 (180 aa), FASTA scores: opt: 519, E(): 3.9e-25, (47.4% identity in 173 aa overlap); etc. Belongs to the oligoribonuclease family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28271572827804+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2511|orn
VQDELVWIDCEMTGLDLGSDKLIEIAALVTDADLNILGDGVDVVMHADDAALSGMIDVVAEMHSRSGLIDEVKASTVDLATAEAMVLDYINEHVKQPKTAPLAGNSIATDRAFIARDMPTLDSFLHYRMIDVSSIKELCRRWYPRIYFGQPPKGLTHRALADIHESIRELRFYRRTAFVPQPGPSTSEIAAVVAELSDGAGAQEETDSAEAPQSG