Gene Mb2559Ac
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb39 |
Comments | Mb2559Ac, -, len: 74 aa. Equivalent to Rv2530A,len: 74 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 74 aa overlap). Conserved hypothetical protein, similar to Q9CCR7|ML0525 HYPOTHETICAL PROTEIN from Mycobacterium leprae (58 aa), FASTA scores: opt: 179,E(): 1.8e-06, (63.65% identity in 44 aa overlap). Highly similar to O53218|Rv2493 from Mycobacterium tuberculosis (73 aa), FASTA scores: opt: 240, E(): 5.7e-11, (56.75% identity in 74 aa overlap); and Q92WE1|RB0399|SMB20413 HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti)p lasmid pSymB (megaplasmid 2) (75 aa), FASTA scores: opt: 226, E(): 6.5e-10, (56.00% identity in 75 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2821480 | 2821704 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2559Ac|vapb39 MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV
Bibliography
No article yet recorded