Gene Rv2530A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB39 |
| Comments | Rv2530A, len: 74 aa. Possible vapB39, antitoxin, part of toxin-antitoxin (TA) operon with Rv2530c, see Arcus et al. 2005. Similar to others in Mycobacterium tuberculosis e.g. O53218|Rv2493 (73 aa), FASTA scores: opt: 240, E(): 5.7e-11, (56.75% identity in 74 aa overlap); and Q92WE1|RB0399|SMB20413 hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti)p lasmid pSymB (megaplasmid 2) (75 aa), FASTA scores: opt: 226, E(): 6.5e-10, (56.00% identity in 75 aa overlap). |
| Functional category | - |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2854683 | 2854907 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2530A|vapB39
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV
Bibliography
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant